PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang02g14120.1
Common NameLR48_Vigan10g280400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 194aa    MW: 21736.9 Da    PI: 9.8509
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang02g14120.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.24.3e-14153193243
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksr 43 
                      g WT+eEd  lv++v+++G + W+ Ia+ ++ gR +kqc++r
   Vang02g14120.1 153 GWWTPEEDSSLVELVNEFGLKKWTQIAKFLP-GRIGKQCRER 193
                      55*****************************.********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.948147193IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.3E-17148193IPR009057Homeodomain-like
SuperFamilySSF466891.08E-13148193IPR009057Homeodomain-like
SMARTSM007177.4E-5151193IPR001005SANT/Myb domain
PfamPF002494.9E-13153193IPR001005SANT/Myb domain
CDDcd001671.99E-13155193No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MFPSQSPILI PSSPPPPIMF HPNNTFHHIQ DHTFGIPTQN PNFLFEGPLK PTTTPFCGML  60
TPSLGSSLGG FANVSHHHPM MLPPPNNNNA LHGQHEGKVI WDFSQKTMIH PSYASSSSNS  120
PSPLSFPNIT QYKWKSNQKI KMKKDTNDLI IKGWWTPEED SSLVELVNEF GLKKWTQIAK  180
FLPGRIGKQC RER*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150440.0AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014490478.11e-109PREDICTED: transcription factor MYB98-like
TrEMBLA0A0L9VPT31e-140A0A0L9VPT3_PHAAN; Uncharacterized protein
STRINGGLYMA03G15930.21e-59(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF4072722
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27785.16e-16myb domain protein 118
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]